Product Overview FOXO4-DRI is a synthetic D-retro-inverso (DRI) cell-penetrating peptide designed to disrupt the FOXO4-p53 interaction. It is supplied as a lyophilized powder for stability in laboratory settings.
Key Specifications
- CAS Number: 2460055-10-9
- Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
- Molecular Weight: 5358.05 g/mol
- Sequence: ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D-amino acids; lowercase denotes D-configuration)
- Form: White lyophilized powder in sealed glass vial
- Quantity: 10mg per vial
- Purity: ≥99% (verified by third-party HPLC testing)
- Storage: Store lyophilized at -20°C; reconstituted solutions at 2-8°C. Protect from light and moisture.
- Solubility: Soluble in bacteriostatic water or sterile saline for research reconstitution.
Research Notes FOXO4-DRI is a senolytic peptide commonly used in in vitro and preclinical studies exploring disruption of FOXO4-p53 binding, selective induction of apoptosis in senescent cells, cellular senescence pathways, and tissue homeostasis models. Independent Certificates of Analysis (COAs) and lab reports are provided with each batch for verification of identity, purity, and endotoxin levels.
Important Disclaimer This product is intended strictly for research purposes only. It is not for human or veterinary consumption, diagnostic, or therapeutic use. Not evaluated by the FDA. Researchers must comply with all applicable laws and regulations.
| Weight | 0.0625 lbs |
|---|
Related products
